PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g56260.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family CO-like
Protein Properties Length: 369aa    MW: 41026.1 Da    PI: 7.1834
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g56260.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.71.7e-062567440
          zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                      r C+ ++  +   +C+ +  +lC++C  + H+       H++v
  Bradi3g56260.2.p 25 RPCDGCHATPSMVYCRVDAAYLCASCDAQVHSAnrvasrHERV 67
                      67*****************************657788888776 PP

2zf-B_box26.99.8e-0967112342
          zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                        r+C+ +e+ ++ l C+ +   lC +C  + H+       H++vp+
  Bradi3g56260.2.p  67 VRVCEICESAPAVLACRADAAALCTTCDAQVHSAnpiaqrHQRVPV 112
                       689*****************************66899999999986 PP

3CCT66.57.2e-23299342144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++lRYkeK++ RkF+K+irY++RKa+Ae RpRvKGrF+k++
  Bradi3g56260.2.p 299 REARVLRYKEKKQARKFQKTIRYATRKAYAEARPRVKGRFAKRS 342
                       9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003363.6E-62269IPR000315B-box-type zinc finger
PfamPF006433.3E-52567IPR000315B-box-type zinc finger
CDDcd000217.28E-72569No hitNo description
PROSITE profilePS501199.6272769IPR000315B-box-type zinc finger
PROSITE profilePS5011911.16365112IPR000315B-box-type zinc finger
PfamPF006432.4E-767112IPR000315B-box-type zinc finger
CDDcd000218.31E-968112No hitNo description
SMARTSM003361.9E-970112IPR000315B-box-type zinc finger
PfamPF062036.7E-17299341IPR010402CCT domain
PROSITE profilePS5101716.073299341IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009658Biological Processchloroplast organization
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 369 aa     Download sequence    Send to blast
MFMNCNFNCN LLEQEAGRRN FPWARPCDGC HATPSMVYCR VDAAYLCASC DAQVHSANRV  60
ASRHERVRVC EICESAPAVL ACRADAAALC TTCDAQVHSA NPIAQRHQRV PVLPLSAVAI  120
SAASGFAEVR AATIHGDKEE GEEVDSWLLL RRNSDDNNCS NSIDRYFNLV GYNPYYDNAT  180
CNPGPGEQYR LQEQQVQNRY REKEGSECVV PSQIVMASEE QESGYRIIGT EQAAFMTVGA  240
STYTASISNS ISFSSMEVGI VPDNTRPDIS KTNILTTSGA MELSVHSVQM PVHFSSMDRE  300
ARVLRYKEKK QARKFQKTIR YATRKAYAEA RPRVKGRFAK RSDIEHEVNH MLSPPVLPES  360
SYGTVPWF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003570457.10.0PREDICTED: zinc finger protein HD1-like
SwissprotQ9FDX81e-127HD1_ORYSJ; Zinc finger protein HD1
TrEMBLI1IEA10.0I1IEA1_BRADI; Uncharacterized protein
STRINGBRADI3G56260.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56223140
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.12e-69CONSTANS-like 2